missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. PDE7A Antibody, R&D Systems™

PDE7A Antibody, R&D Systems™

Código de producto. 18499010 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
25 μL
0.1 mL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18499010 25 μL 25 microlitros
18229866 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18499010 Proveedor Novus Biologicals N.º de proveedor NBP18327525ul
  • ONLINE EXCLUSIVE PRICE
    433.00€
    409.50€ / 25 microlitros
    Ahorro 23.50€
    5% Descuento
 Artículo restringido
Fecha estimada de envoi: 09-10-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PDE7A Polyclonal specifically detects PDE7A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno PDE7A
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen EC 3.1.4, EC 3.1.4.17, HCP1high affinity cAMP-specific 3'-5'-cyclic phosphodiesterase 7A, PDE7, phosphodiesterase 7A, phosphodiesterase isozyme 7, TM22
Símbolos de los genes PDE7A
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:FMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 5150
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.