missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PCGF5 Polyclonal specifically detects PCGF5 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antígeno | PCGF5 |
| Aplicaciones | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gen | MGC16202, polycomb group ring finger 5, polycomb group RING finger protein 5, ring finger protein (C3HC4 type) 159, RING finger protein 159, RNF159 |
| Símbolos de los genes | PCGF5 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:TCIVQHFEDSNDCPRCGNQVHETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKAD |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?