missing translation for 'onlineSavingsMsg'
Learn More

PAPSS1 Antibody, Novus Biologicals™

Código de producto. 18407171 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25ul
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18407171 25ul 25 microlitros
18024189 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18407171 Proveedor Novus Biologicals N.º de proveedor NBP21373025ul

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

PAPSS1 Polyclonal specifically detects PAPSS1 in Human samples. It is validated for Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno PAPSS1
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Simple Western 1:25, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen 3'-phosphoadenosine 5'-phosphosulfate synthase 1, ATPSK1SK 1, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1, EC 2.7.1.25, PAPS synthase 1, PAPSS 1, PAPSS3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1, SK1, Sulfurylase kinase 1
Símbolos de los genes PAPSS1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the amino acids: QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE
Método de purificación Affinity Purified
Cantidad 25ul
Estado normativo RUO
Disciplina de investigación Proteases & Other Enzymes
Primario o secundario Primary
ID de gen (Entrez) 9061
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.