missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Palladin Antibody - Azide and BSA Free, R&D Systems™

Palladin Antibody - Azide and BSA Free, R&D Systems™

Código de producto. 18603272 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18603272 0.02 mL 0.02 ml
18671442 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18603272 Proveedor Novus Biologicals N.º de proveedor NBP2939830.02ml
 Artículo restringido
Fecha estimada de envoi: 02-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Palladin Polyclonal specifically detects Palladin in Human, Mouse, Rat samples. It is validated for ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation, Western Blot.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Palladin
Aplicaciones ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation, Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:500 - 1:1000, Immunohistochemistry-Paraffin
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen CGI151, CGI-151, FLJ22190, FLJ38193, KIAA0992FLJ39139, MYN, myoneurin, palladin, palladin, cytoskeletal associated protein, PNCA1, Sarcoma antigen NY-SAR-77, SIH002FLJ61376
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 383-672 of human PALLD (NP_001159582.1). AVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL
Método de purificación Affinity purified
Cantidad 0.02 mL
Estado normativo RUO
Disciplina de investigación Cell Biology, Cellular Markers, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 23022
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Tipo de producto Antibody
Formulario Purified
Isotype IgG
Línea de productos Novus
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.