missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Odf1 Antibody - Azide and BSA Free, R&D Systems™

Odf1 Antibody - Azide and BSA Free, R&D Systems™

Código de producto. 18606580 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18606580 0.1 mL 0.10 ml
18659650 0.02 mL 0.02 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18606580 Proveedor Novus Biologicals N.º de proveedor NBP2936010.1ml
 Artículo restringido
Fecha estimada de envoi: 03-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Odf1 Polyclonal specifically detects Odf1 in Human, Mouse, Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Odf1
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500-1:2000
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen cancer/testis antigen 133, CT133, HSPB10, MGC129928, MGC129929, ODF, ODF2, ODF27, ODFP, ODFPG, ODFPGA, ODFPGB, outer dense fiber of sperm tails 1, outer dense fiber of sperm tails, 27-kD, outer dense fiber protein 1, outer dense fibre of sperm tails 1, RT7, SODF
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2). LYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
Método de purificación Affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 4956
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Tipo de producto Antibody
Formulario Purified
Isotype IgG
Línea de productos Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.