missing translation for 'onlineSavingsMsg'
Learn More

NIF3L1 Antibody, Novus Biologicals™

Código de producto. 30232960 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
20 μL
100 μL
Tamaño de la unidad:
100 microlitros
20 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30232960 100 μL 100 microlitros
30232810 20 μL 20 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30232960 Proveedor Novus Biologicals N.º de proveedor NBP333552100ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Monoclonal Antibody

NIF3L1 Monoclonal antibody specifically detects NIF3L1 in Human,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno NIF3L1
Aplicaciones ELISA, Western Blot
Clasificación Monoclonal
Conjugado Unconjugated
Dilución Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Formulación PBS (pH 7.3), 50% glycerol, 0.05% BSA
Alias de gen ALS2CR1, candidate 1, MDS015, NIF3 NGG1 interacting factor 3-like 1 (S. pombe), NIF3-like protein 1, S.pombe homolog)-like 1
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 250-350 of human NIF3L1 (Q9GZT8).,, Sequence:, MGRLCTLDESVSLATMIDRIKRHLKLSHIRLALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 60491
Especies diana Human, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.