missing translation for 'onlineSavingsMsg'
Learn More

NFATC2/NFAT1 Antibody, Novus Biologicals™

Código de producto. 18402331 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
0.1 mL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18402331 0.1 mL 0.10 ml
18491761 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18402331 Proveedor Novus Biologicals N.º de proveedor NBP182582

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

NFATC2/NFAT1 Polyclonal antibody specifically detects NFATC2/NFAT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno NFATC2/NFAT1
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen NFAT pre-existing subunit, NFAT transcription complex, preexisting component, NFAT1nuclear factor of activated T-cells, cytoplasmic 2, NFATc2, NF-ATc2, NFATp, NF-ATp, NFATPnuclear factor of activated T-cells, preexisting component, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2, preexisting nuclear factor of activated T-cells 2, T cell transcription factor NFAT1, T-cell transcription factor NFAT1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids: GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Adaptive Immunity, Immunology, Transcription Factors and Regulators, Wnt Signaling Pathway
Primario o secundario Primary
ID de gen (Entrez) 4773
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.