missing translation for 'onlineSavingsMsg'
Learn More

NBPF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Código de producto. 18348075 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18348075 100 μg 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18348075 Proveedor Novus Biologicals N.º de proveedor NBP309754100UL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

NBPF1 Polyclonal specifically detects NBPF1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno NBPF1
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml
Formulación PBS buffer, 2% sucrose
Especie del huésped Rabbit
Inmunógeno The immunogen is a synthetic peptide directed towards the C-terminal region of human NBPF1 (NP_060410.2). Peptide sequence YRSAFYVLEQQRVGLAVDMDEIEKYQEVEEDQDPSCPRLSRELLDEKEPE
Método de purificación Affinity purified
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 55672
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.