missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NBL1 (Human) Recombinant Protein

Human NBL1 full-length ORF ( AAH12037, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00004681-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16108161

  • 508.00€ / 25 microgramos
Envío estimado: 14-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
Especificaciones

Especificaciones

AAH12037
neuroblastoma, suppression of tumorigenicity 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NBL1
GST
4681
Wheat germ expression system
25 μg
D1S1733E, DAN, DAND1, MGC8972, NB, NO3
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales