missing translation for 'onlineSavingsMsg'
Learn More

Myotrophin Antibody, Novus Biologicals™

Código de producto. 18498799 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
0.05 mg
Tamaño de la unidad:
50 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18498799 0.05 mg 50 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18498799 Proveedor Novus Biologicals N.º de proveedor H00136319B03P
 Artículo restringido
Fecha estimada de envoi: 28-09-2026
Añadir a la cesta
Añadir a la cesta
Este artículo no se puede devolver. Vea la política de devoluciones

Mouse Polyclonal Antibody

Myotrophin Polyclonal antibody specifically detects Myotrophin in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Myotrophin
Aplicaciones Western Blot, Immunocytochemistry/Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:100-1:2000, Immunocytochemistry/ Immunofluorescence 1:10-1:500
Formulación PBS (pH 7.4)
N.º de referencia del gen NP_665807.1
Alias de gen FLJ31098, FLJ99857, GCDP, granule cell differentiation protein, myotrophin, Protein V-1, V-1
Especie del huésped Mouse
Inmunógeno MTPN (NP_665807.1, 1 a.a. - 118 a.a.) full-length human protein. MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Método de purificación Protein A purified
Cantidad 0.05 mg
Estado normativo RUO
Disciplina de investigación Neuroscience
Primario o secundario Primary
ID de gen (Entrez) 136319
Especies diana Human
Contenido y almacenamiento Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.