missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Reactivos bioquímicos
  4. Péptidos
  5. 18222009

R&D Systems™ MTO1 Recombinant Protein Antigen

Code produit 18222009 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Cantidad:
0,1 mL
Conditionnement:
0.10 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Cantidad Conditionnement
18222009 0,1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18222009 Fournisseur R&D Systems™ Code fournisseur NBP185933PEP
 Artículo restringido
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTO1. The MTO1 Recombinant Protein Antigen is derived from E. coli. The MTO1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-85933. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 25821
Especie Human
Línea de productos Novus
Método de purificación Chromatography
Pureza >80%
Concentración 0.5mg/mL
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulación PBS and 1M Urea, pH 7.4.
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Símbolo de gen MTO1
Tipo de etiqueta Unlabeled
Peso molecular 26kDa
Tipo de producto MTO1
Cantidad 0,1 mL
Estado normativo RUO
Fuente E.Coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85933. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Inmunógeno RPDNADSRLTLRGYKDAGCVSQQRYERACWMKSSLEEGISVLKSIEFLSSKWKKLIPEASISTSRSLPVRALDVLKYE
Show More Show Less

Para uso exclusivo en investigación

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.