missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. MRPL3 Antibody, Novus Biologicals™

MRPL3 Antibody, Novus Biologicals™

Código de producto. 18254234 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18254234 100 μL 100 microlitros
18601469 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18254234 Proveedor Novus Biologicals N.º de proveedor NBP255722

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

MRPL3 Polyclonal specifically detects MRPL3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antígeno MRPL3
Aplicaciones Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen 39S ribosomal protein L3, mitochondrial, mitochondrial ribosomal protein L3, MRL3mitochondrial, L3, RPML3
Símbolos de los genes MRPL3
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGA
Método de purificación Affinity Purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 11222
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.