missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Reactivos bioquímicos
  4. Péptidos
  5. 18725663

Novus Biologicals™ Methionine Sulfoxide Reductase A Recombinant Protein Antigen

Código de producto. 18725663 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0,1 mL
Tamaño de la unidad:
0.10 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18725663 0,1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18725663 Proveedor Novus Biologicals™ N.º de proveedor NBP187456PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSRA. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87456. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 4482
Especie Human
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulación PBS and 1M Urea, pH 7.4.
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Símbolo de gen MSRA
Tipo de etiqueta Unlabeled
Peso molecular 25kDa
Tipo de producto Methionine Sulfoxide Reductase A
Cantidad 0,1 mL
Estado normativo RUO
Inmunógeno ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG
Mostrar más Mostrar menos

Para uso exclusivo en investigación

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.