missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. MED9 Antibody, R&D Systems™

MED9 Antibody, R&D Systems™

Código de producto. 18120484 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
25 μL
0.1 mL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18120484 0.1 mL 0.10 ml
18457391 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18120484 Proveedor Novus Biologicals N.º de proveedor NBP231639
  • ONLINE EXCLUSIVE PRICE
    625.06€
    590.10€ / 0.1 ml
    Ahorro 34.96€
    5% Descuento
 Artículo restringido
Fecha estimada de envoi: 02-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MED9 Polyclonal specifically detects MED9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).

TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno MED9
Aplicaciones Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen Q9NWA0
Alias de gen FLJ10193mediator of RNA polymerase II transcription, subunit 9 homolog, MED25mediator of RNA polymerase II transcription subunit 9, mediator complex subunit 9MGC138234, mediator of RNA polymerase II transcription, subunit 9 homolog (S. cerevisiae), mediator subunit 25
Símbolos de los genes MED9
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP
Método de purificación Affinity Purified
Cantidad 0.1 mL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 55090
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.