missing translation for 'onlineSavingsMsg'
Learn More

Kv11.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Código de producto. 18360265 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
25 μg
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18360265 25 μg 25 microlitros
18392125 100 μg 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18360265 Proveedor Novus Biologicals N.º de proveedor NBP31036625UL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Kv11.1 Polyclonal specifically detects Kv11.1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Kv11.1
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml
Formulación PBS buffer, 2% sucrose
Alias de gen Eag homolog, Eag-related protein 1, ERG, erg1, ERG-1, Ether-a-go-go-related gene potassium channel 1, ether-a-go-go-related potassium channel protein, Ether-a-go-go-related protein 1, H-ERG, HERG1, HERGhERG-1, Kv11.1, LQT2, potassium voltage-gated channel subfamily H member 2, potassium voltage-gated channel, subfamily H (eag-related), member 2, SQT1, Voltage-gated potassium channel subunit Kv11.1
Especie del huésped Rabbit
Inmunógeno The immunogen is a synthetic peptide directed towards the C-terminal region of human Kv11.1 (NP_742054). Peptide sequence SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG
Método de purificación Affinity purified
Cantidad 25 μg
Estado normativo RUO
Disciplina de investigación Neuroscience, Neurotransmission, Potassium Channels
Primario o secundario Primary
ID de gen (Entrez) 3757
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.