missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Kif2a Antibody, R&D Systems™

Kif2a Antibody, R&D Systems™

Código de producto. 18620778 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
25 μL
100 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18620778 25 μL 25 microlitros
18240734 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18620778 Proveedor Novus Biologicals N.º de proveedor NBP25511625ul
 Artículo restringido
Fecha estimada de envoi: 01-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Kif2a Polyclonal specifically detects Kif2a in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Kif2a
Aplicaciones Immunocytochemistry, Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen HK2, KIF2kinesin-2, kinesin heavy chain member 2, kinesin heavy chain member 2A, Kinesin, heavy chain, 2, Kinesin-2, kinesin-like protein KIF2A, KNS2
Símbolos de los genes KIF2A
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TAAGDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRA
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cancer, Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 3796
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.