missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. KCC2/SLC12A5 Antibody, Novus Biologicals™

KCC2/SLC12A5 Antibody, Novus Biologicals™

Código de producto. 18610749 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Produktkode Cantidad unitSize
18610749 25 μL 25 microlitros
18634458 0.1 mL 0.10 ml
2 missing translation for 'options'
Denne vare kan ikke returneres. Se returpolitik

Produktkode 18610749

missing translation for 'mfr': Novus Biologicals NBP24967425ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

Rabbit Polyclonal Antibody

KCC2/SLC12A5 Polyclonal antibody specifically detects KCC2/SLC12A5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antígeno KCC2/SLC12A5
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Formulación PBS (pH 7.2), 40% Glycerol
Alias de gen Electroneutral potassium-chloride cotransporter 2, hKCC2, KCC2K-Cl cotransporter 2, KIAA1176erythroid K-Cl cotransporter 2, Neuronal K-Cl cotransporter, solute carrier family 12 (potassium/chloride transporter), member 5, solute carrier family 12 member 5
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC
Método de purificación Immunogen affinity purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Potassium Channels
Primario o secundario Primary
ID de gen (Entrez) 57468
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.