missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
KCC1/SLC12A4 Polyclonal specifically detects KCC1/SLC12A4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antígeno | KCC1/SLC12A4 |
| Aplicaciones | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gen | Electroneutral potassium-chloride cotransporter 1, Erythroid K-Cl cotransporter 1, FLJ17069, FLJ40489, hKCC1, KCC1erythroid K:Cl cotransporter, K-Cl cotransporter, potassium/chloride cotransporter 1, solute carrier family 12 (potassium/chloride transporters), member 4, solute carrier family 12 member 4 |
| Símbolos de los genes | SLC12A4 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?