missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Jagged 1 Antibody (1E12), Novus Biologicals™
Mouse Monoclonal Antibody
Marca: Novus Biologicals H00000182-M01A
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Jagged 1 Monoclonal antibody specifically detects Jagged 1 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Gene Knock-Out
Especificaciones
| Jagged 1 | |
| Monoclonal | |
| Unconjugated | |
| Ascites | |
| AGS, AHDMGC104644, Alagille syndrome, AWS, CD339, CD339 antigen, HJ1, jagged 1, Jagged1, JAGL1, protein jagged-1 | |
| JAG1 (NP_000205, 531 a.a. ∽ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG | |
| 0.2 mL | |
| Angiogenesis, Cancer, Growth and Development, Neuronal Cell Markers, Stem Cell Signaling Pathway | |
| 182 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
| Western Blot, ELISA, Immunohistochemistry, Gene Knock-Out | |
| 1E12 | |
| Western Blot 1:500, ELISA, Immunohistochemistry, Knockout Validated | |
| NP_000205 | |
| Mouse | |
| Unpurified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Jagged 1 Antibody (1E12), Novus Biologicals™ > 0.2 mL; Unconjugated
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido