missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. IGF2BP1 Antibody, R&D Systems™

IGF2BP1 Antibody, R&D Systems™

Código de producto. 18620656 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
25 μL
0.1 mL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18620656 25 μL 25 microlitros
18095186 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18620656 Proveedor Novus Biologicals N.º de proveedor NBP23895625ul
 Artículo restringido
Fecha estimada de envoi: 02-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

IGF2BP1 Polyclonal specifically detects IGF2BP1 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno IGF2BP1
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04 - 0.4 μg/mL, Simple Western 1:10, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen Q9NZI8
Alias de gen Coding region determinant-binding protein, CRD-BP, CRDBPIGF-II mRNA-binding protein 1, IGF II mRNA binding protein 1, IMP1, IMP-1ZBP-1, insulin-like growth factor 2 mRNA binding protein 1, insulin-like growth factor 2 mRNA-binding protein 1, VICKZ family member 1, VICKZ1, ZBP1IGF2 mRNA-binding protein 1, Zip code-binding protein 1, Zipcode-binding protein 1
Símbolos de los genes IGF2BP1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 10642
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Tipo de producto Antibody
Isotype IgG
Línea de productos Novus
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.