Learn More
Invitrogen™ Human ZNF608 (aa 967-1042) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP109607
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ZNF608 gene ontology annotations related to this gene include nucleic acid binding.
Especificaciones
Q9ULD9 | |
Blocking Assay, Control | |
57507 | |
100 μL | |
4932417D18Rik; D430007A19Rik; Kiaa1281; LOW QUALITY PROTEIN: zinc finger protein 608; NY-REN-36; renal carcinoma antigen NY-REN-36; Zfp608; Zinc finger protein 608; Znf608 | |
ZNF608 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ZNF608 (aa 967-1042) Control Fragment | |
RUO | |
ZNF608 | |
Unconjugated | |
Recombinant | |
DIISSKDSVVKGHSSTTAQSSQLKESHSPYYHSYDPYYSPSYMHPGQVGAPAAGNSGSTQGMKIKKESEEDAEKKD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.