missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30211573

Invitrogen™ Human ZIP14 (aa 250-344) Control Fragment Recombinant Protein

Código de producto. 30211573
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30211573 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30211573 Proveedor Invitrogen™ N.º de proveedor RP91214

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The zinc transporter ZIP14, also known as SLC39A14, is a member of a family of divalent ion transporters. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. The zinc transporter family is divided into four subfamilies (I, II, LIV-1 and gufA). ZIP14 is a glycosylated multipass plasma membrane protein that belongs to the ZIP transporter subfamily LIV-1. ZIP14 has been shown to contribute to the hypozincemia of inflammation and infection and is regulated in the liver by IL-6. In addition to zinc, ZIP14 is also involved in the cellular uptake of non-transferrin-bound iron as well as iron bound to transferrin.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q15043
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 23516
Nombre Human ZIP14 (aa 250-344) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen cig19; Factor for adipocyte differentiation 123; Fad123; FAD-123; HMNDYT2; Kiaa0062; LIV-1 subfamily of ZIP zinc transporter 4; LZT-Hs4; NET34; SLC39A14; solute carrier family 39 (metal ion transporter), member 14; solute carrier family 39 (zinc transporter), member 14; solute carrier family 39 member 14; Zinc transporter ZIP14; Zip14; ZIP-14; Zrt- and Cig19; Zrt- and Irt-like protein 14; Zrt-, Irt-like protein 14
Nombre común ZIP14
Símbolo de gen SLC39A14
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSD
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.