missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human WISP3 (aa 23-65) Control Fragment Recombinant Protein

Código de producto. 30209684
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30209684 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30209684 Proveedor Invitrogen™ N.º de proveedor RP107316

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85059 (PA5-85059. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WISP3 is a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like domain. WISP3 is overexpressed in colon tumors. It may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Mutations of the WISP3 gene are associated with progressive pseudorheumatoid dysplasia, an autosomal recessive skeletal disorder, indicating that the gene is essential for normal postnatal skeletal growth and cartilage homeostasis.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O95389
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 8838
Nombre Human WISP3 (aa 23-65) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen CCN family member 6; CCN6; Cellular communication network factor 6; ENSMUSG00000062074; Gm735; LIBC; PPAC; PPD; RGD1564120; UNQ462/PRO790/PRO956; Wisp3; WISP-3; WNT1 inducible signaling pathway protein 3; WNT1-inducible-signaling pathway protein 3
Nombre común WISP3
Símbolo de gen CCN6
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.