missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30207829

Invitrogen™ Human TRK fused gene (aa 308-396) Control Fragment Recombinant Protein

Código de producto. 30207829
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30207829 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30207829 Proveedor Invitrogen™ N.º de proveedor RP92560

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53996 (PA5-53996. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TFG protein, a recently identified novel protein, is a human homolog of mouse TFG protein. It contains an N-terminal coiled-coil structure, a SPYGQ-rich region followed by octicosapeptide repeats. Research shows that TFG can modulate SHP-1 activity and is a novel member of the NF-kB pathway. The physiological functions of this protein remain largely elusive, but TFG is thought to function by associating with other proteins, including TANK and NEMO. TFG was first identified as a partner of NTRK1 and is involved in generating the thyroid TRK-T3 oncogene, as well as oncogenic rearrangements with ALK in anaplastic lymphoma and NOR1 in mixoid chondrosarcoma.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q92734
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 10342
Nombre Human TRK fused gene (aa 308-396) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI173908; HMSNP; protein TFG; SPG57; TF6; TFG; Trk-fused gene; TRK-fused gene protein; TRKT3; TRKT3 oncogene
Nombre común TRK fused gene
Símbolo de gen TFG
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.