missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30200159

Invitrogen™ Human TCP-1 zeta (aa 493-530) Control Fragment Recombinant Protein

Código de producto. 30200159
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30200159 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30200159 Proveedor Invitrogen™ N.º de proveedor RP104349

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60193 (PA5-60193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein TCP-1 (t complex polypeptide 1) is a subunit of the heterooligomeric complex CCT (chaperonin containing TCP-1) present in the eukaryotic cytosol. The CCT of eukaryotic cytosol is composed of eight different subunit species, TCP-1 alpha, beta, gamma, delta, epsilon, zeta, eta and theta, each encoded by a different gene. Two zeta subunits have been described: TCP-1 zeta (also designated TCP-1 zeta1) and TCP-1 zeta2. TCP-1 subunits are proposed to have independent functions in folding its in vivo substrates, the actins and tubulins. TCP-1 was first identified in the mouse as relevant for tail-less and embryonic lethal phenotypes. Sequences homologous to TCP-1 have been isolated in several other species, and the yeast TCP-1 has been shown to encode a molecular chaperone for Actin and Tubulin. TCP-1 found in mammalian cells and yeast plays an important role in the folding of cytosolic proteins.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P40227
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 908
Nombre Human TCP-1 zeta (aa 493-530) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen acute morphine dependence related protein 2; acute morphine dependence-related protein 2; amino acid transport defect-complementing; CCT zeta1; CCT- zeta1; CCT- zeta-1; CCT zeta-1; Cct6; Cct6a; Cctz; Cctz1; Cctz-1; CCT-zeta; CCT-zeta-1; chaperonin containing T-complex subunit 6; chaperonin containing TCP-1; chaperonin containing TCP1 subunit 6 A; chaperonin containing Tcp1, subunit 6 A (zeta 1); chaperonin containing Tcp1, subunit 6 A (zeta); chaperonin subunit 6 A (zeta); histidine transp; histidine transport regulator 3; HTR3; MoDP-2; T-complex protein 1 subunit zeta; T-complex protein 1, zeta subunit; TCP 1 zeta; TCP1 zeta; TCP-1- zeta; TCP1- zeta; TCP-1-zeta; Tcp20; TCPZ; TTCP20
Nombre común TCP-1 zeta
Símbolo de gen CCT6A
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.