missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30194866

Invitrogen™ Human TANC1 (aa 1491-1574) Control Fragment Recombinant Protein

Código de producto. 30194866
Change view
Click to view available options
Cantidad:
100 μL
Unit Size:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
30194866 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30194866 Supplier Invitrogen™ Supplier No. RP96006

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57797 (PA5-57797. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TANC1 (Tetratricopeptide repeat, ankyrin repeat and coiled-coil domain-containing protein 1) is a PSD-95-interacting synaptic protein that is proposed to play a role in the regulation of dendritic spines and excitatory synapses and spatial memory.
TRUSTED_SUSTAINABILITY

Specifications

Número de acceso Q9C0D5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 85461
Nombre Human TANC1 (aa 1491-1574) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1200003E16Rik; KIAA1728; mKIAA1728; Protein TANC1; rolling pebbles homolog B; ROLSB; Tanc; TANC1; tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1; tetratricopeptide repeat, ankyrin repeat and coiled-coil domain-containing protein 1; TPR domain, ankyrin-repeat and coiled-coil domain-containing protein 1; TPR domain, ankyrin-repeat and coiled-coil-containing; TPR domain, ankyrin-repeat and coiled-coil-containing protein
Nombre común TANC1
Símbolo de gen TANC1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LQEGLQSKGRPVSPQSRAGIGKSLREPVAQPGLLLQPSKQAQIVKTSQHLGSGQSAVRNGSMKVQISSQNPPPSPMPGRIAATP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.