missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SVOP (aa 508-548) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP91230
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53448 (PA5-53448. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SVOP gene ontology (GO) annotation includes transmembrane transporter activity and synaptic vesicle membrane.
Especificaciones
| Q8N4V2 | |
| Blocking Assay, Control | |
| 55530 | |
| 100 μL | |
| 1110030H18Rik; AI415691; msvop; SV2 related protein; SV2 related protein homolog; SV2-related protein; Svop; Synaptic vesicle 2-related protein | |
| SVOP | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SVOP (aa 508-548) Control Fragment | |
| RUO | |
| SVOP | |
| Unconjugated | |
| Recombinant | |
| LPIETKGRGLQESSHREWGQEMVGRGMHGAGVTRSNSGSQE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human SVOP (aa 508-548) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido