missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RCOR1 (aa 438-485) Control Fragment Recombinant Protein

Código de producto. 30200194
Cambiar vista
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30200194 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30200194 Proveedor Invitrogen™ N.º de proveedor RP106227

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83960 (PA5-83960. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RCOR1 is a functional corepressor required for regulation of neural-specific gene expression. The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression. The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9UKL0
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 23186
Nombre Human RCOR1 (aa 438-485) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 5730409O11; 6720480E22Rik; AU042633; COREST; D12Wsu95e; im:6904264; KIAA0071; LOC102554884; mKIAA0071; Protein CoREST; RCOR; Rcor1; REST corepressor 1; REST corepressor 1-like; Rocr1; si:dkey-46n18.7; zgc:158607
Nombre común RCOR1
Símbolo de gen RCOR1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.