missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RAGE (aa 47-82) Control Fragment Recombinant Protein

Código de producto. 30212778
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30212778 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30212778 Proveedor Invitrogen™ N.º de proveedor RP109188

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Receptor for Advanced Glycation End-products (RAGE) is a gene located on human chromosome 6p21.3, encoding a transmembrane receptor belonging to the immunoglobulin superfamily. RAGE is expressed in various tissues, with significant levels in the lungs, and plays a crucial role in cellular signaling and inflammation. As a receptor, RAGE binds multiple ligands, including advanced glycation end-products (AGEs), amyloid-beta peptide, high mobility group box 1 (HMGB1), and S100/calgranulin proteins, facilitating diverse pathological processes like inflammation, cancer progression, and neurodegeneration. The interaction between RAGE and its ligands triggers intracellular signaling pathways such as NF-kB activation, leading to inflammatory responses and oxidative stress. In the context of chronic diseases like diabetes, Alzheimer's, and cardiovascular diseases, RAGE is a critical mediator, linking metabolic disturbance to cellular dysfunction. Therapeutic targeting of RAGE signaling is under investigation, aiming to mitigate its contribution to inflammatory and degenerative diseases.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q15109
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Neutralization, Control
Formulación PBS, 1M urea with no preservative; pH 7.4
ID de gen (Entrez) 177
Nombre Human RAGE (aa 47-82) Control Fragment
Intervalo de pH 7.4
Método de purificación Purified
Cantidad 100 μL
Requisitos de almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Estado normativo RUO
Alias de gen advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Nombre común RAGE
Símbolo de gen AGER
Tipo de producto Protein
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.