missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Abnova™ Human RAET1G Partial ORF (NP_001001788.1, 124 a.a. - 213 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human RAET1G Partial ORF (NP_001001788.1, 124 a.a. - 213 a.a.) Recombinant Protein with GST-tag at N-terminal

Código de producto. 16182877
Change view
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16182877 10 μg 10 microgramos
16192877 25 μg 25 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16182877 Proveedor Abnova™ N.º de proveedor H00353091Q01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo actualmente no está disponible o ha sido discontinuado.
Ver la página del producto para posibles alternativas
 Ver productos alternativos

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Used for AP, Array, ELISA, WB-Re

Members of the RAET1 family, such as RAET1G, are major histocompatibility complex (MHC) class I-related genes located within a 180-kb cluster on chromosome 6q24.2-q25.3. RAET1 proteins contain MHC class I-like alpha-1 and alpha-2 domains. RAET1E (MIM 609243) and RAET1G differ from the other RAET1 proteins (e.g., RAET1I, or ULBP1; MIM 605697) in that they have type I membrane-spanning sequences at their C termini rather than glycosylphosphatidylinositol anchor sequences. (Radosavljevic et al., 2002 [PubMed 11827464]).[supplied by OMIM]

Sequence: RMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGGTV

Especificaciones

Número de acceso NP_001001788.1
Para utilizar con (aplicación) Antibody Production, ELISA, Protein Array, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 353091
Peso molecular 35.64kDa
Nombre RAET1G (Human) Recombinant Protein (Q01)
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 10 μg
Inmunógeno RMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGGTV
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Estado normativo RUO
Nombre común RAET1G
Símbolo de gen RAET1G
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Sistema de expresión wheat germ expression system
Formulario Liquid
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.