missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30180688

Invitrogen™ Human PPP1R12C (aa 148-233) Control Fragment Recombinant Protein

Código de producto. 30180688
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30180688 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Product Code. 30180688 Supplier Invitrogen™ Supplier No. RP99011

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60408 (PA5-60408. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The gene encodes a subunit of myosin phosphatase. The encoded protein regulates the catalytic activity of protein phosphatase 1 delta and assembly of the actin cytoskeleton. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Número de acceso Q9BZL4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 54776
Nombre Human PPP1R12C (aa 148-233) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen LENG3; leukocyte receptor cluster (LRC) encoded novel gene 3; leukocyte receptor cluster (LRC) member 3; MBS85; myosin-binding subunit 85; p84; p85; PPP1R12C; protein phosphatase 1 myosin-binding subunit of 85 kDa; Protein phosphatase 1 myosin-binding subunit p85; protein phosphatase 1 regulatory subunit 12 C; protein phosphatase 1, regulatory (inhibitor) subunit 12 C; protein phosphatase 1, regulatory subunit 12 C
Nombre común PPP1R12C
Símbolo de gen PPP1R12C
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.