missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human p21 (aa 45-155) Control Fragment Recombinant Protein Código de producto.: 30198102

Invitrogen™ Human p21 (aa 45-155) Control Fragment Recombinant Protein

Código de producto. 30198102
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198102

Marca: Invitrogen™ RP105703

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein p21 is a tumor suppressor protein which is an inhibitor of Cyclin-dependent kinases (CDK) and is transcriptionally activated by p53. P21 is important in the response of cells to genotoxic stress and a major transcriptional target of p53 protein. The occurrence of p21 in the nucleus executes binding and inhibition activity of cyclin dependent kinases Cdk1 and Cdk2, and blocks the transition from G1 phase into S phase or from G2 phase into mitosis after DNA damage, which enables the repair of damaged DNA. In the cytoplasm, p21 protein has an anti-apoptotic effect. P21 is able to bind to and inhibit caspase 3, as well as the apoptotic kinases ASK1 and JNK. P21 exhibits a dual function in carcinogenesis, and acts as a tumor suppressor, prevents apoptosis, and acts as an oncogene.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P38936
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1026
Nombre Human p21 (aa 45-155) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Activating Fragment 1; CAP20; cdk inhibitor CIP1; cdk inhibitor CIP1 (p21); CDKI; CDK-interacting protein 1; CDK-interaction protein 1; Cdkn1; CDKN1A; CDNK1A; CIP1; Cip1); cyclin dependent kinase inhibitor 1 A; cyclin-dependent kinase inhibitor 1; cyclin-dependent kinase inhibitor 1 A; Cyclin-dependent kinase inhibitor 1 A (p21; cyclin-dependent kinase inhibitor 1 A (P21); cyclin-dependent kinase inhibitor 1 A (p21, Cip1); cyclin-dependent kinase inhibitor 1 A variant 1; cyclin-dependent kinase inhibitor 1 A variant 2; DNA synthesis inhibitor; MDA6; MDA-6; melanoma differentiation associated protein 6; melanoma differentiation-associated protein; Melanoma differentiation-associated protein 6; OTTHUMP00000016298; p21; p21Cip1; p21Cip1/Waf1; p21WAF; PIC1; putative cyclin-dependent kinase inhibitor 1 A (p21/WAF1/CIP1); SDI1; SLC12A9; UV96; WAF1; Wild type p53 activated fragment 1 (WAF1); wild-type p53-activated fragment 1
Nombre común p21
Símbolo de gen CDKN1A
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia ARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human p21 (aa 45-155) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado