missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30181548

Invitrogen™ Human NSFL1C (aa 87-158) Control Fragment Recombinant Protein

Código de producto. 30181548
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30181548 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30181548 Proveedor Invitrogen™ N.º de proveedor RP99300

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62224 (PA5-62224. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

p47, also known as NSFL1C, UBX1, UBXD10 or UBXN2C, is a 370 amino acid protein that localizes to both the nucleus and the golgi apparatus (specifically to golgi stacks) and contains one SEP domain and one UBX domain. Functioning as part of a ternary complex with VCP (a protein involved in the heterotypic fusion of transport vesicles with their target membranes) and Syntaxin 5, p47 interacts with and reduces the ATPase activity of VCP and is required for the fragmentation of golgi stacks during mitosis and for subsequent reassembly of golgi stacks after mitosis. p47 is subject to phosphorylation during mitosis, which inhibits p47-golgi interaction and is, therefore, required for proper golgi stack formation and cisternal regrowth. Human p47 shares 89% sequence identity with its mouse counterpart, suggesting a conserved role between species. Multiple isoforms of p47 exist due to alternative splicing events.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9UNZ2
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 55968
Nombre Human NSFL1C (aa 87-158) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen dJ776F14.1; Munc-18 c; NSFL1 (p97) cofactor (p47); NSFL1 cofactor; NSFL1 cofactor p47; NSFL1C; p47; p97 cofactor p47; RP4-776F14.2; SHP1 homolog; Stxbp3a; UBX domain-containing protein 2 C; UB x 1; UBXD10; UBXN2C; XY body-associated protein XY40; XY40
Nombre común NSFL1C
Símbolo de gen Nsfl1c
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.