missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30209695

Invitrogen™ Human MTERFD3 (aa 46-189) Control Fragment Recombinant Protein

Código de producto. 30209695
Cambiar vista
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30209695 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30209695 Proveedor Invitrogen™ N.º de proveedor RP102232

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51952 (PA5-51952. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the mTERF (mitochondrial transcription termination factor) family, are mitochondrial proteins that are believed to be transcription termination factors. MTERFD3 was initially identified through differential display analysis and is expressed primarily in heart, liver, pancreas and skeletal muscle. MTERFD3 is believed to be involved in cell cycle regulation and cell growth by modulating mitochondrial transcription, and may be a serum-inhibitory factor.
TRUSTED_SUSTAINABILITY

Specifications

Número de acceso Q49AM1
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 80298
Nombre Human MTERFD3 (aa 46-189) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1700007D05Rik; mitochondrial transcription termination factor 2; Mitochondrial transcription termination factor-like protein; MTERF domain containing 3; mTERF domain-containing protein 3, mitochondrial; MTERF2; Mterfd3; mTERFL; mTERF-like; RGD1311836; Transcription termination factor 2, mitochondrial
Nombre común MTERFD3
Símbolo de gen MTERF2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TRTVEKLYKCSVDIRKIRRLKGWVLLEDETYVEEIANILQELGADETAVASILERCPEAIVCSPTAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.