missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30206581

Invitrogen™ Human MRP7 (aa 1217-1280) Control Fragment Recombinant Protein

Código de producto. 30206581
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30206581 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30206581 Proveedor Invitrogen™ N.º de proveedor RP94746

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59646 (PA5-59646. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The MRP family is represented by nine similar ABC transporters that have the ability to transport structurally diverse lipophilic anions and operate as chemical efflux pumps. MRP7 (multidrug resistance-associated protein 7, ATPbinding cassette sub-family C member 10) is a multi-pass membrane protein that belongs to the ABC transporter family (conjugate transporter subfamily). MRP7 is involved with the ATP-dependent transport of 17β-estradiol-D-17-β-glucuronide (E217βG). MRP7 is also probably involved in cellular detoxification through its lipophilic anion extrusion capabilities. MRP7 contains two ABC transmembrane type 1 domains and two ABC transporter domains. MRP7 likely has three isoforms. Isoform 2 is the most widely expressed, while isoform 1 is predominately expressed in the spleen.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q5T3U5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 89845
Nombre Human MRP7 (aa 1217-1280) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ABCC10; ATP binding cassette subfamily C member 10; ATP-binding cassette sub-family C member 10; ATP-binding cassette, subfamily C (CFTR/MRP), member 10; ATP-binding cassette, sub-family C (CFTR/MRP), member 10; EST182763; mFLJ00002; Mrp7; Multidrug resistance-associated protein 7; SIMRP7
Nombre común MRP7
Símbolo de gen ABCC10
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia RLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLPNALDGVTFCVQPGEKLGIVG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.