missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30195699

Invitrogen™ Human MGARP (aa 165-240) Control Fragment Recombinant Protein

Código de producto. 30195699
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30195699 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30195699 Proveedor Invitrogen™ N.º de proveedor RP109226

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MGARP plays a role in the trafficking of mitochondria along microtubules. It regulates the kinesin-mediated axonal transport of mitochondria to nerve terminals along microtubules during hypoxia. It participates in the translocation of TRAK2/GRIF1 from the cytoplasm to the mitochondrion. It also plays a role in steroidogenesis through maintenance of mitochondrial abundance and morphology.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8TDB4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 84709
Nombre Human MGARP (aa 165-240) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen C4orf49; CESP1; CESP-1; Corneal endothelium-specific protein 1; GS3582; HUMMR; hypoxia up-regulated mitochondrial movement regulator protein; MGARP; mitochondria localized glutamic acid rich protein; mitochondria-localized glutamic acid-rich protein; OSAP; ovary-specific acidic protein; Protein MGARP
Nombre común MGARP
Símbolo de gen MGARP
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia ARETTEVNPETTPEVTNAALDEAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEAASAQG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.