missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human KIAA0100 (aa 2096-2202) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP100185
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60118 (PA5-60118. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Belongs to the UPF0378 family. 4 isoforms of the human protein are produced by alternative splicing. Song J., Biochim. Biophys. Acta 1760:62-69(2006). Nagase T., DNA Res. 2:37-43(1995). Chen G., Leuk. Res. 29:503-509(2005).
Especificaciones
| Q14667 | |
| Blocking Assay, Control | |
| 9703 | |
| 100 μL | |
| Antigen MLAA-22; BCOX; BCO x 1; breast cancer overexpressed gene 1; breast cancer-overexpressed gene 1 protein; cancer/testis antigen 101; CT101; FMP27; K0100; KIAA0100; protein KIAA0100; U937-associated antigen | |
| KIAA0100 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human KIAA0100 (aa 2096-2202) Control Fragment | |
| RUO | |
| KIAA0100 | |
| Unconjugated | |
| Recombinant | |
| EHPVDDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEKNSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKRDSRKALVAQVIKEKLRLKSATGSEVRGKLETKSDLN | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human KIAA0100 (aa 2096-2202) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido