missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30211079

Invitrogen™ Human IGF2BP2 (aa 325-396) Control Fragment Recombinant Protein

Código de producto. 30211079
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30211079 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30211079 Proveedor Invitrogen™ N.º de proveedor RP96287

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IGF2BP2 is a member of the IGF-II mRNA-binding protein (IMP) family. It recruits target transcripts to cytoplasmic protein-RNA complexes. The protein contains several four KH domains and two RRM domains. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Autoantibodies against IGF2BP2 are detected in sera from some patients with hepatocellular carcinoma.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9Y6M1
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 10644
Nombre Human IGF2BP2 (aa 325-396) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen C330012H03Rik; Hepatocellular carcinoma autoantigen p62; IGF2 mRNA-binding protein 2; IGF2BP2; IGF-II mRNA-binding protein 2; Imp2; IMP-2; insulin like growth factor 2 mRNA binding protein 2; insulin-like growth factor 2 mRNA binding protein 2; insulin-like growth factor 2 mRNA-binding protein 2; insulin-like growth factor 2, binding protein 2; Neilsen; p62; RGD1305614; VICKZ family member 2; VICKZ2
Nombre común IGF2BP2
Símbolo de gen IGF2BP2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.