missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HYKK (aa 11-90) Control Fragment Recombinant Protein

Código de producto. 30182740
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30182740 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30182740 Proveedor Invitrogen™ N.º de proveedor RP98178

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59259 (PA5-59259. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Número de acceso A2RU49
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 123688
Nombre Human HYKK (aa 11-90) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 5-hydroxy-L-lysine kinase; 5-hydroxylysine kinase; AGPHD1; aminoglycoside phosphotransferase domain containing 1; aminoglycoside phosphotransferase domain-containing protein 1; C630028N24Rik; Hydroxylysine kinase; hydroxylysine kinase 1; HYKK; RGD1308677
Nombre común HYKK
Símbolo de gen HYKK
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia ALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.