missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30194172

Invitrogen™ Human HKR1 (aa 225-290) Control Fragment Recombinant Protein

Código de producto. 30194172
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30194172 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30194172 Proveedor Invitrogen™ N.º de proveedor RP106075

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65392 (PA5-65392. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. The majority of zinc-finger proteins contain a Kruppeltype DNA binding domain and a KRAB domain, which is thought to interact with KAP1, thereby recruiting histone modifying proteins. HKR1, also known as Krueppel-related zinc finger protein 1 or zinc finger protein 875, is a 659 amino acid nuclear protein that is thought to play a role in transcriptional regulation. Existing as two alternatively spliced isoforms, HKR1 is a member of the Krueppel C2H2-type zinc-finger protein family and contains thirteen C2H2-type zinc fingers and one KRAB domain. The gene encoding HKR1 maps to human chromosome 19q13.12.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P10072
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 284459
Nombre Human HKR1 (aa 225-290) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen GLI-Kruppel family member HKR1; HKR1; HKR1, GLI-Kruppel zinc finger family member; Krueppel-related zinc finger protein 1; oncogene HKR1; Protein HKR1; Zinc finger protein 875; ZNF875
Nombre común HKR1
Símbolo de gen HKR1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia ADLEETDKVLHGLEVSGFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.