missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GPR10 (aa 23-60) Control Fragment Recombinant Protein

Código de producto. 30194424
Cambiar vista
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30194424 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30194424 Proveedor Invitrogen™ N.º de proveedor RP95307

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRLHR is a 7-transmembrane domain receptor for prolactin-releasing hormone (PRLH) that is highly expressed in anterior pituitary (Ozawa et al., 2002).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P49683
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2834
Nombre Human GPR10 (aa 23-60) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen G protein-coupled receptor 10; Gm339; GPR10; G-protein coupled receptor 10; GR3; hGR3; MGC126539; MGC126541; Prlhr; prolactin releasing hormone receptor; prolactin releasing peptide receptor; prolactin-releasing hormone receptor; prolactin-releasing peptide receptor; PrRP receptor; Prrpr; UHR-1
Nombre común GPR10
Símbolo de gen PRLHR
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.