missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human FLIP (aa 6-111) Control Fragment Recombinant Protein Código de producto.: 30203162

Invitrogen™ Human FLIP (aa 6-111) Control Fragment Recombinant Protein

Código de producto. 30203162
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30203162

Marca: Invitrogen™ RP92580

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FLIP (CFLAR) is an apoptosis regulator protein which functions as a crucial link between cell survival and cell death pathways in mammalian cells. It acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O15519
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 8837
Nombre Human FLIP (aa 6-111) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2310024N18Rik; A430105C05Rik; Cash; CASP8 and FADD like apoptosis regulator; CASP8 and FADD-like apoptosis regulator; CASP8 and FADD-like apoptosis regulator subunit p12; CASP8 and FADD-like apoptosis regulator subunit p43; CASP8AP1; caspase homolog; Caspase-eight-related protein; caspase-like apoptosis regulatory protein; caspase-related inducer of apoptosis; Casper; Cellular FLICE-like inhibitory protein; Cflar; c-Flip; c-FLIPL; c-FLIPR; c-FLIPS; CLARP; ENSMUSG00000072980; FADD-like antiapoptotic molecule 1; FLAME; FLAME1; FLAME-1; Flip; Gm9845; I-FLICE; Inhibitor of FLICE; MACH-related inducer of toxicity; MRIT; testis secretory sperm-binding protein Li 233 m; usurpin; usurpin beta
Nombre común FLIP
Símbolo de gen CFLAR
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human FLIP (aa 6-111) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado