missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ECHS1 (aa 149-290) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP93144
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54593 (PA5-54593. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.
Especificaciones
| P30084 | |
| Blocking Assay, Control | |
| 1892 | |
| 100 μL | |
| C80529; ECHS1; ECHS1D; enoyl CoA hydratase, short chain, 1, mitochondrial; enoyl Coenzyme A hydratase, short chain 1; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial; enoyl-CoA hydratase 1; Enoyl-CoA hydratase short chain 1 mitochondrial; enoyl-CoA hydratase, mitochondrial; enoyl-CoA hydratase, short chain 1; Enoyl-CoA hydratase, short chain 1, mitochondrial; enoyl-CoA hydratase, short chain, 1, mitochondrial; mitochondrial short-chain enoyl-coenzyme A hydratase 1; SCEH; short chain enoyl-CoA hydratase; short-chain enoyl-CoA hydratase | |
| Echs1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ECHS1 (aa 149-290) Control Fragment | |
| RUO | |
| ECHS1 | |
| Unconjugated | |
| Recombinant | |
| CDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human ECHS1 (aa 149-290) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido