Learn More
Invitrogen™ Human DOCK1 (aa 1614-1693) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106449
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84144 (PA5-84144. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Especificaciones
Q14185 | |
Blocking Assay, Control | |
1793 | |
100 μL | |
180 kDa protein downstream of CRK; 9130006G06Rik; AI854900; ced5; D630004B07Rik; dedicator of cytokinesis 1; dedicator of cyto-kinesis 1; dedicator of cytokinesis protein 1; dock 180; DOCK1; DOCK180; DOwnstream of CrK; RGD1566072; RP11-82L9.1 | |
DOCK1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human DOCK1 (aa 1614-1693) Control Fragment | |
RUO | |
DOCK1 | |
Unconjugated | |
Recombinant | |
VRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.