missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CRSP130 (aa 245-324) Control Fragment Recombinant Protein

Código de producto. 30195377
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30195377 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30195377 Proveedor Invitrogen™ N.º de proveedor RP105501

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84839 (PA5-84839. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CRSP is ubiquitously expressed in various tissues and functions as a multimeric complex that consists of nine distinct subunits. Several members of the CRSP family share sequence similarity with multiple components of the yeast transcriptional mediator proteins, including CRSP150, which is related to yeast Rgr1, and CRSP70, which is similar to the elongation factor TFIIS. CRSP77 and CRSP150 are also related to proteins within the putative murine mediator complex, while CRSP130 and CRSP34 are largely unrelated to either murine or yeast proteins. CRSP subunits also associate with larger multimeric co-activator complexes, including ARC/DRI, which binds directly to SREBP and nuclear hormone receptors to facilitate transcription, and with NAT, a polymerase II-interacting complex that represses activated transcription.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9ULK4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9439
Nombre Human CRSP130 (aa 245-324) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 130 kDa transcriptional co-activator; 130 kDa; 133 kDa transcriptional co-activator; 3000002A17Rik; activator-recruited cofactor 130 kDa component; ARC130; Cofactor required for Sp1 transcriptional activation subunit 3; cofactor required for Sp1 transcriptional activation, subunit 3 (130 kD); CRSP complex subunit 3; CRSP130; CRSP133; Crsp3; DRIP130; ESTM7; hSur-2; KIAA1216; Med23; Mediator complex subunit 23; mediator complex subunit MED23 variant MED23_i6; mediator complex subunit MED23 variant MED23_i7; mediator of RNA polymerase II transcription subunit 23; mKIAA1216; MRT18; mSur-2; Protein sur-2 homolog; SUR2; SUR-2; Transcriptional coactivator CRSP130; vitamin D3 receptor interacting protein; Vitamin D3 receptor-interacting protein complex 130 kDa component; X83317
Nombre común CRSP130
Símbolo de gen MED23
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.