missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CENPE (aa 392-509) Control Fragment Recombinant Protein

Código de producto. 30196638
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30196638 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30196638 Proveedor Invitrogen™ N.º de proveedor RP89483

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144699 (PA5-144699, PA5-59939 (PA5-59939. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

14-3-3 sigma (stratifin, SFN, epithelial cell marker protein 1) is a member of a highly conserved family of 14-3-3 proteins that are present in all eukaryotic organisms. There are 7 known mammalian 14-3-3 isoforms epsilon, beta, zeta, gamma, theta, tau and they play important roles in many biological activities by binding to and altering the subcellular localization and/or stability of key molecules in various signaling cascades. 14-3-3 sigma was originally characterized as a human mammary epithelium marker and later rediscovered as an important molecule for cell cycle checkpoint regulation. Recently it has been reported that 14-3-3 sigma may serve as a prognosis marker predicting survival of pancreatic cancer patient treatment. 14-3-3 sigmais the only 14-3-3 isoform induced by the tumor suppressor protein p53, in response to g-irradiation and other DNA-damaging agents. 14-3-3 sigmais a p53-regulated inhibitor of G2/M progression and acts as a tumor suppressor gene that is inactivated by methylation of its 5' CpG islands in epithelial tumor cells. Two isoforms of human 14-3-3 sigma are produced by alternative splicing.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q02224
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1062
Nombre Human CENPE (aa 392-509) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 312 kDa; AU019344; BC049989; C530022J18; Cenpe; CENP-E; centromere autoantigen E; Centromere autoantigen E (312 kD); centromere protein E; centromere protein E, 312 kDa; centromere-associated protein E; centromeric protein E; KIF10; kinesin 10; kinesin family member 10; kinesin superfamily protein 10; Kinesin-7; Kinesin-related protein CENPE; MCPH13; Motor domain of KIF10; N-7 kinesin; PPP1R61; protein phosphatase 1, regulatory subunit 61
Nombre común CENPE
Símbolo de gen CENPE
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.