missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human CDK5RAP2 (aa 471-618) Control Fragment Recombinant Protein Código de producto.: 30194437

Invitrogen™ Human CDK5RAP2 (aa 471-618) Control Fragment Recombinant Protein

Código de producto. 30194437
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194437

Marca: Invitrogen™ RP106126

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83824 (PA5-83824. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK5RAP2 is a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein is localized to the centrosome and Golgi complex and interacts with CDK5R1 and pericentrin (PCNT). CDK5RAP2 plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimer's disease. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96SN8
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 55755
Nombre Human CDK5RAP2 (aa 471-618) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen C48; CDK5 activator-binding protein C48; CDK5 regulatory subunit associated protein 2; CDK5 regulatory subunit-associated protein 2; CDK5RAP2; centrosomal protein 215 kDa; Centrosome-associated protein 215; centrosomin; Cep215; KIAA1633; MCPH3
Nombre común CDK5RAP2
Símbolo de gen CDK5RAP2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIFSKEKKQSSDYEELIQVLKKEQDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSYQNLRKTLEEQISEIRRR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human CDK5RAP2 (aa 471-618) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado