missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CDK5RAP2 (aa 471-618) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106126
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83824 (PA5-83824. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CDK5RAP2 is a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein is localized to the centrosome and Golgi complex and interacts with CDK5R1 and pericentrin (PCNT). CDK5RAP2 plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimer's disease. Alternative splicing results in multiple transcript variants.
Especificaciones
| Q96SN8 | |
| Blocking Assay, Control | |
| 55755 | |
| 100 μL | |
| C48; CDK5 activator-binding protein C48; CDK5 regulatory subunit associated protein 2; CDK5 regulatory subunit-associated protein 2; CDK5RAP2; centrosomal protein 215 kDa; Centrosome-associated protein 215; centrosomin; Cep215; KIAA1633; MCPH3 | |
| CDK5RAP2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CDK5RAP2 (aa 471-618) Control Fragment | |
| RUO | |
| CDK5RAP2 | |
| Unconjugated | |
| Recombinant | |
| KLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIFSKEKKQSSDYEELIQVLKKEQDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSYQNLRKTLEEQISEIRRR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human CDK5RAP2 (aa 471-618) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido