missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CDK11A (aa 688-765) Control Fragment Recombinant Protein

Código de producto. 30207755
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30207755 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30207755 Proveedor Invitrogen™ N.º de proveedor RP105663

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84929 (PA5-84929. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PITSLRE beta1 protein, a distantly related member of the Cdk family of protein kinases, induces apoptosis after low levels of ectopic expression. Apoptosis, or programmed cell death, is similarly induced by ectopic expression of an amino terminal deletion mutant retaining the catalytic and carboxyterminal domains of PITSLRE beta1, but not by other mutants lacking Histone H1 kinase activity or by other Cdk family members. The terminology for the ten isoforms of the PITSLRE subfamily of proteins is based on the conserved PSTAIRE box region of Cdc2 p34. Depending on which of the PITSLRE genes produce the protein, the cDNA and protein are designated alpha, beta or gamma (i.e., PITSLRE A gene, alpha; PITSLRE B gene, beta and PITSLRE C gene, gamma). Some of the isoforms such as PITSLRE alpha1 (T cells) and PITSLRE beta1 (B cells and brain), are expressed in specific cell types, while others are expressed ubiquitously.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9UQ88
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 728642
Nombre Human CDK11A (aa 688-765) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen CDC2L2; CDC2L3; CDK11 p110; CDK11 p46; CDK11 p58; CDK11A; CDK11-p110; CDK11-p46; CDK11-p58; cell division cycle 2-like 2 (PITSLRE proteins); cell division cycle 2-like protein kinase 2; Cell division protein kinase 11 A; cyclin dependent kinase 11 A; cyclin-dependent kinase 11 A; Galactosyltransferase-associated protein kinase p58/GTA; p58GTA; PITSLRE; PITSLRE B; PITSLRE protein kinase beta; PITSLRE serine/threonine-protein kinase CDC2L2; PITSLREB
Nombre común CDK11A
Símbolo de gen CDK11A
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.