missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212326

Invitrogen™ Human CACNA1I (aa 1842-1934) Control Fragment Recombinant Protein

Código de producto. 30212326
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30212326 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30212326 Proveedor Invitrogen™ N.º de proveedor RP110066

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144944 (PA5-144944. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CaV3.3 encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by CaV3.3 is characterized by a slower activation and inactivation compared to other T-type calcium channels. CaV3.3 may be involved in calcium signaling in neurons. Alternate splicing results in multiple transcript variants of CaV3.3. Voltage-gated calcium channels (CaV) are present in the membrane of most excitable cells and mediate calcium influx in response to depolarization, an proteins such as CaV3.3 regulate intracellular processes such as contraction, secretion, neurotransmission and gene expression. Diseases associated with CACNA1I include Childhood Absence Epilepsy.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9P0X4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 8911
Nombre Human CACNA1I (aa 1842-1934) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Ca(v)3.3; CACNA1I; calcium channel, voltage-dependent, alpha 1 I subunit; calcium channel, voltage-dependent, T type, alpha 1 I subunit; calcium voltage-gated channel subunit alpha1 I; Cav3.3; CaVT0.3; hypothetical gene supported by NM_020084; KIAA1120; low voltage-activated T-type calcium channel alpha-1 subunit (CACNA1I); low-voltage-activated calcium channel alpha13.3; RP1-172B20.4; voltage-dependent calcium channel; voltage-dependent T-type calcium channel subunit alpha-1 I; Voltage-gated calcium channel subunit alpha Cav3.3
Nombre común CACNA1I
Símbolo de gen CACNA1I
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia HHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.