Learn More
Invitrogen™ Human AHNAK (aa 5583-5716) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP92506
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53890 (PA5-53890. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
AHNAK1 (Desmoyokin) is a large (700 kDa) scaffold protein that translocates to the plasma membrane after an increas of extracellular calcium level or upon proteinkinase C activation and regulates extracellular calcium influx mediated by L-type Ca2+ channels. AHNAK1 has been implicated in diverse signal transduction proceses affecting cell differentiation and proliferation. In response to calcium-dependent intercellular contacts AHNAK1 forms multimeric complexes in the plasma membrane, connected with actin and annexin 2/S100A10 assemblies and is thus involved in organization of the plasma membrane architecture. In epithelial cells, AHNAK1 is localized in cytoplasm or is membrane-associated, but in cells of nonepithelial origin AHNAK1 is predominantly nuclear; it has a weak DNA-binding activity and associates with the DNA-ligase IV-XRCC4 complex.
Especificaciones
Q09666 | |
Blocking Assay, Control | |
79026 | |
100 μL | |
AHNAK; AHNAK 1; AHNAK nucleoprotein; AHNAK nucleoprotein (desmoyokin); AHNAK-related; AHNAKRS; Desmoyokin; DY6; MGC5395; Neuroblast differentiation-associated protein AHNAK; PM227; RGD1308572; UV118 | |
AHNAK | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human AHNAK (aa 5583-5716) Control Fragment | |
RUO | |
AHNAK | |
Unconjugated | |
Recombinant | |
LGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSGPKVEGGVKGGQIGLQAPGLSVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKAEASIQAGAGDGEWEESEVKLKKSKIKMPK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.