missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AHNAK (aa 5583-5716) Control Fragment Recombinant Protein

Código de producto. 30199681
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30199681 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30199681

Marca: Invitrogen™ RP92506

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53890 (PA5-53890. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AHNAK1 (Desmoyokin) is a large (700 kDa) scaffold protein that translocates to the plasma membrane after an increas of extracellular calcium level or upon proteinkinase C activation and regulates extracellular calcium influx mediated by L-type Ca2+ channels. AHNAK1 has been implicated in diverse signal transduction proceses affecting cell differentiation and proliferation. In response to calcium-dependent intercellular contacts AHNAK1 forms multimeric complexes in the plasma membrane, connected with actin and annexin 2/S100A10 assemblies and is thus involved in organization of the plasma membrane architecture. In epithelial cells, AHNAK1 is localized in cytoplasm or is membrane-associated, but in cells of nonepithelial origin AHNAK1 is predominantly nuclear; it has a weak DNA-binding activity and associates with the DNA-ligase IV-XRCC4 complex.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q09666
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 79026
Nombre Human AHNAK (aa 5583-5716) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AHNAK; AHNAK 1; AHNAK nucleoprotein; AHNAK nucleoprotein (desmoyokin); AHNAK-related; AHNAKRS; Desmoyokin; DY6; MGC5395; Neuroblast differentiation-associated protein AHNAK; PM227; RGD1308572; UV118
Nombre común AHNAK
Símbolo de gen AHNAK
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSGPKVEGGVKGGQIGLQAPGLSVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKAEASIQAGAGDGEWEESEVKLKKSKIKMPK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.